PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0052100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 323aa    MW: 34501.7 Da    PI: 8.3165
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0052100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.2e-3995154261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     +ek+l+cprC s+ tkfCyynny+l+qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s
  Spipo0G0052100  95 PEKILPCPRCSSMATKFCYYNNYNLNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKHS 154
                     78999*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2887152IPR003851Zinc finger, Dof-type
PfamPF027018.7E-3297153IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.45399153IPR003851Zinc finger, Dof-type
PROSITE patternPS013610101137IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MAGSRGLVKL FGKTIPVPVE VDIQEDPFKE TGGGGGAGGE RGEAEDEDDA GKQLPVLAVE  60
SSGSASDGKS EQRTSSSAGR SLSGGGEKNP KPAKPEKILP CPRCSSMATK FCYYNNYNLN  120
QPRHFCKNCQ RYWTAGGTMR NVPVGAGRRK NKHSAAYCRH ITVVKPPLSP EEHVPVFHAE  180
EKSNSAAGDG WGENAPCFSG NPWACPISVY PMAAYWSVPW MSPSSSPAVG KKHPRQGEAE  240
PERCLWFPKT LRIDDPVEAA KSSIWAAMGL SKDMAARGGL FTGFDQAKNN PSASITEASK  300
VFLANPAAMS RSFSFQESSI LD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0218936e-60AC021893.18 Genomic Sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0060A14, from chromosome 10, complete sequence.
GenBankAP0149666e-60AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankCP0126186e-60CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ93ZL57e-57CDF2_ARATH; Cyclic dof factor 2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20993793
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.12e-55cycling DOF factor 1